Vascular endothelial growth factor A

Vascular endothelial growth factor A

Member of the PDGF/VEGF growth factor family

Monoclonal Antibody From Mouse And Human

Lab Reagents

Human Antibody Laboratories manufactures the monoclonal antibody from mouse and human reagents distributed by Genprice. The Monoclonal Antibody From Mouse And Human reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human Antibody. Other Monoclonal products are available in stock. Specificity: Monoclonal Category: Antibody Group: From Mouse

From Mouse information

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-DY633 0.1mg
EUR 466.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 633.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-FITC 0.1mg
EUR 469.2
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with FITC.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-HRP 0.1mg
EUR 464.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with HRP.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-P594 0.1mg
EUR 487.2
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with PE/ATTO 594.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-PCP 0.1mg
EUR 477.6
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with PerCP.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-RPE 0.1mg
EUR 475.2
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with RPE.

Monoclonal antibody for SUR1 and SUR2B

SMC-432D-STR 0.1mg
EUR 476.4
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Streptavidin.

Monoclonal antibody for SUR1 and SUR2B

SMC-432S 0.012mg
EUR 78
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Rat Anti Human Macrophages And Neutrophils Monoclonal Antibody

DMABT-49599RH 200 TEST
EUR 920.4

Mouse Anti Rat Granulocytes And Erythroid Cells Monoclonal Antibody

DMABT-49809MR 2 ml
EUR 1057.2

P16 (Mouse and Human) Antibody

abx016045-100ul 100 ul
EUR 493.2

P16 (Mouse and Human) Antibody

abx016046-100ul 100 ul
EUR 493.2

Matching Pair - DNA from Human Primary and Metastatic Tumor Tissue: Breast

D8235086-PM-10 2x10 ug
EUR 732
Description: Can be used for various studies in the realm of gene expression, both normal and pathological. It is an excellent control and suitable for educational purposes.

Matching Pair - DNA from Human Primary Tumor and Normal Tissue: Breast

D8235086-PP-10 2x10 ug
EUR 464.4
Description: Can be used for various studies in the realm of gene expression, both normal and pathological. It is an excellent control and suitable for educational purposes.

Matching Pair - DNA from Human Primary and Metastatic Tumor Tissue: Colon

D8235090-PM-10 2x10 ug
EUR 732
Description: Can be used for various studies in the realm of gene expression, both normal and pathological. It is an excellent control and suitable for educational purposes.

Matching Pair - DNA from Human Primary Tumor and Normal Tissue: Colon

D8235090-PP-10 2x10 ug
EUR 464.4
Description: Can be used for various studies in the realm of gene expression, both normal and pathological. It is an excellent control and suitable for educational purposes.

Matching Pair - DNA from Human Primary and Metastatic Tumor Tissue: Kidney

D8235142-PM-10 2x10 ug
EUR 732
Description: Can be used for various studies in the realm of gene expression, both normal and pathological. It is an excellent control and suitable for educational purposes.