Monoclonal Antibody From Mouse And Human
Lab Reagents
Human Antibody Laboratories manufactures the monoclonal antibody from mouse and human reagents distributed by Genprice. The Monoclonal Antibody From Mouse And Human reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human Antibody. Other Monoclonal products are available in stock. Specificity: Monoclonal Category: Antibody Group: From Mouse
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D-DY594 | Stressmarq | 0.1mg | EUR 472.8 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 594. |
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D-DY633 | Stressmarq | 0.1mg | EUR 466.8 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 633. |
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D-FITC | Stressmarq | 0.1mg | EUR 469.2 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with FITC. |
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D-HRP | Stressmarq | 0.1mg | EUR 464.4 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with HRP. |
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D-P594 | Stressmarq | 0.1mg | EUR 487.2 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with PE/ATTO 594. |
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D-PCP | Stressmarq | 0.1mg | EUR 477.6 |
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with PerCP. |
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D-RPE | Stressmarq | 0.1mg | EUR 475.2 |
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with RPE. |
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D-STR | Stressmarq | 0.1mg | EUR 476.4 |
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Streptavidin. |
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432S | Stressmarq | 0.012mg | EUR 78 |
Description: A monoclonal antibody from clone S323A-31 against Human SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Mouse Anti Rat Granulocytes And Erythroid Cells Monoclonal Antibody |
|||
DMABT-49809MR | Creative Diagnostics | 2 ml | EUR 1057.2 |
Matching Pair - DNA from Human Primary and Metastatic Tumor Tissue: Breast |
|||
D8235086-PM-10 | Biochain | 2x10 ug | EUR 732 |
Description: Can be used for various studies in the realm of gene expression, both normal and pathological. It is an excellent control and suitable for educational purposes. |
Matching Pair - DNA from Human Primary Tumor and Normal Tissue: Breast |
|||
D8235086-PP-10 | Biochain | 2x10 ug | EUR 464.4 |
Description: Can be used for various studies in the realm of gene expression, both normal and pathological. It is an excellent control and suitable for educational purposes. |
Matching Pair - DNA from Human Primary and Metastatic Tumor Tissue: Colon |
|||
D8235090-PM-10 | Biochain | 2x10 ug | EUR 732 |
Description: Can be used for various studies in the realm of gene expression, both normal and pathological. It is an excellent control and suitable for educational purposes. |
Matching Pair - DNA from Human Primary Tumor and Normal Tissue: Colon |
|||
D8235090-PP-10 | Biochain | 2x10 ug | EUR 464.4 |
Description: Can be used for various studies in the realm of gene expression, both normal and pathological. It is an excellent control and suitable for educational purposes. |
Matching Pair - DNA from Human Primary and Metastatic Tumor Tissue: Kidney |
|||
D8235142-PM-10 | Biochain | 2x10 ug | EUR 732 |
Description: Can be used for various studies in the realm of gene expression, both normal and pathological. It is an excellent control and suitable for educational purposes. |
Matching Pair - DNA from Human Primary Tumor and Normal Tissue: Kidney |
|||
D8235142-PP-10 | Biochain | 2x10 ug | EUR 464.4 |
Description: Can be used for various studies in the realm of gene expression, both normal and pathological. It is an excellent control and suitable for educational purposes. |
Matching Pair - DNA from Human Primary and Metastatic Tumor Tissue: Liver |
|||
D8235149-PM-10 | Biochain | 2x10 ug | EUR 732 |
Description: Can be used for various studies in the realm of gene expression, both normal and pathological. It is an excellent control and suitable for educational purposes. |