Vascular endothelial growth factor A

Vascular endothelial growth factor A

Member of the PDGF/VEGF growth factor family

Igg Antibody For Waht Infectoins

Monoclonal antibody for SUR1 and SUR2B

SMC-432D 0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Igg Antibody Laboratories manufactures the igg antibody for waht infectoins reagents distributed by Genprice. The Igg Antibody For Waht Infectoins reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact igg antibody. Other Igg products are available in stock. Specificity: Igg Category: Antibody Group: For Waht

True Blue

5x5(mg
EUR 2705

JBS True Blue

300µl
EUR 13.7

True Blue Chloride

100mg
EUR 11200
Description: 71431-30-6

JBS True Blue

300 µl
EUR 16
Description: JBS True Blue

True north Cryobox1.5/2mLNatural

PK10
EUR 129.6

True Blue Diaceturate Salt

100mg
EUR 15000
Description: 108321-12-6

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

For Waht information

Human Infectiousmononucleosis IgG, IM-IgG ELISA Kit

MBS9302759-96StripWells 96-Strip-Wells
EUR 765

Human Infectiousmononucleosis IgG?IM-IgG ELISA Kit

201-12-2181 96 tests
EUR 528
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.

Plant Infectious Mononucleosis IgG (IM-IgG) ELISA Kit

MBS9371697-INQUIRE INQUIRE Ask for price

Rat Infectious mononucleosis IgG ELISA

E01A13983 96T
EUR 700
Description: ELISA

Goat Infectious mononucleosis IgG ELISA

E01A48891 96T
EUR 700
Description: ELISA

Human Infectious mononucleosis IgG ELISA

E01A5229 96T
EUR 700
Description: ELISA

Sheep Infectious mononucleosis IgG ELISA

E01A101184 96T
EUR 700
Description: ELISA

Mouse Infectious mononucleosis IgG ELISA

E01A22723 96T
EUR 700
Description: ELISA

Rabbit Infectious mononucleosis IgG ELISA

E01A31459 96T
EUR 700
Description: ELISA

Canine Infectious mononucleosis IgG ELISA

E01A66322 96T
EUR 700
Description: ELISA

Bovine Infectious mononucleosis IgG ELISA

E01A83756 96T
EUR 700
Description: ELISA

Monkey Infectious mononucleosis IgG ELISA

E01A75038 96T
EUR 700
Description: ELISA

Porcine Infectious mononucleosis IgG ELISA

E01A57609 96T
EUR 700
Description: ELISA

Chicken Infectious mononucleosis IgG ELISA

E01A92478 96T
EUR 700
Description: ELISA

Rat Infectious mononucleosis IgG ELISA kit

E02I0001-192T 192 tests
EUR 1524
Description: A sandwich ELISA for quantitative measurement of Rat Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Infectious mononucleosis IgG ELISA kit

E02I0001-48 1 plate of 48 wells
EUR 624
Description: A sandwich ELISA for quantitative measurement of Rat Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Infectious mononucleosis IgG ELISA kit

E02I0001-96 1 plate of 96 wells
EUR 822
Description: A sandwich ELISA for quantitative measurement of Rat Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.