Vascular endothelial growth factor A

Vascular endothelial growth factor A

Member of the PDGF/VEGF growth factor family

Igg Antibody For Waht Infectoins

Monoclonal antibody for SUR1 and SUR2B

SMC-432D 0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Igg Antibody Laboratories manufactures the igg antibody for waht infectoins reagents distributed by Genprice. The Igg Antibody For Waht Infectoins reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact igg antibody. Other Igg products are available in stock. Specificity: Igg Category: Antibody Group: For Waht

JBS True Blue

300 ┬Ál
EUR 16
Description: JBS True Blue

True Blue Chloride

100mg
EUR 11200
Description: 71431-30-6

True north Cryobox1.5/2mLNatural

PK10
EUR 129.6

True Blue Diaceturate Salt

100mg
EUR 15000
Description: 108321-12-6

True Blue (TB) Diaceturate Salt

1mg Ask for price
Description: 108321-12-6

True Blue (TB) Diaceturate Salt

5mg Ask for price
Description: 108321-12-6

Goat True insulin ELISA kit

96T
EUR 700
Description: ELISA

For Waht information

Pig Infectious mononucleosis IgG ELISA kit

E07I0001-192T 192 tests
EUR 1524
Description: A sandwich ELISA for quantitative measurement of Porcine Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Infectious mononucleosis IgG ELISA kit

E07I0001-48 1 plate of 48 wells
EUR 624
Description: A sandwich ELISA for quantitative measurement of Porcine Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Infectious mononucleosis IgG ELISA kit

E07I0001-96 1 plate of 96 wells
EUR 822
Description: A sandwich ELISA for quantitative measurement of Porcine Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Infectious mononucleosis IgG ELISA kit

E08I0001-192T 192 tests
EUR 1524
Description: A sandwich ELISA for quantitative measurement of Canine Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Infectious mononucleosis IgG ELISA kit

E08I0001-48 1 plate of 48 wells
EUR 624
Description: A sandwich ELISA for quantitative measurement of Canine Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Infectious mononucleosis IgG ELISA kit

E08I0001-96 1 plate of 96 wells
EUR 822
Description: A sandwich ELISA for quantitative measurement of Canine Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat Infectious mononucleosis IgG ELISA kit

E06I0001-192T 192 tests
EUR 1524
Description: A sandwich ELISA for quantitative measurement of Goat Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat Infectious mononucleosis IgG ELISA kit

E06I0001-48 1 plate of 48 wells
EUR 624
Description: A sandwich ELISA for quantitative measurement of Goat Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat Infectious mononucleosis IgG ELISA kit

E06I0001-96 1 plate of 96 wells
EUR 822
Description: A sandwich ELISA for quantitative measurement of Goat Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Infectious mononucleosis IgG ELISA kit

E03I0001-192T 192 tests
EUR 1524
Description: A sandwich ELISA for quantitative measurement of Mouse Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Infectious mononucleosis IgG ELISA kit

E03I0001-48 1 plate of 48 wells
EUR 624
Description: A sandwich ELISA for quantitative measurement of Mouse Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Infectious mononucleosis IgG ELISA kit

E03I0001-96 1 plate of 96 wells
EUR 822
Description: A sandwich ELISA for quantitative measurement of Mouse Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Infectious mononucleosis IgG ELISA kit

E01I0001-192T 192 tests
EUR 1524
Description: A sandwich ELISA for quantitative measurement of Human Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Infectious mononucleosis IgG ELISA kit

E01I0001-48 1 plate of 48 wells
EUR 624
Description: A sandwich ELISA for quantitative measurement of Human Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Infectious mononucleosis IgG ELISA kit

E01I0001-96 1 plate of 96 wells
EUR 822
Description: A sandwich ELISA for quantitative measurement of Human Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Guinea Pig Infectious mononucleosis IgG ELISA

E01A40172 96T
EUR 700
Description: ELISA

Rabbit Infectious mononucleosis IgG ELISA kit

E04I0001-192T 192 tests
EUR 1524
Description: A sandwich ELISA for quantitative measurement of Rabbit Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.