Igg Antibody For Waht Infectoins
Monoclonal antibody for SUR1 and SUR2B |
|||
SMC-432D | Stressmarq | 0.1mg | EUR 423.6 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Igg Antibody Laboratories manufactures the igg antibody for waht infectoins reagents distributed by Genprice. The Igg Antibody For Waht Infectoins reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact igg antibody. Other Igg products are available in stock. Specificity: Igg Category: Antibody Group: For Waht
JBS True Blue |
||
MiTeGen | 300 µl | EUR 16 |
Description: JBS True Blue |
True Blue Chloride |
||
Toronto Research Chemicals | 100mg | EUR 11200 |
Description: 71431-30-6 |
True north Cryobox1.5/2mLNatural |
||
Scientific Laboratory Supplies | PK10 | EUR 129.6 |
True Blue Diaceturate Salt |
||
Toronto Research Chemicals | 100mg | EUR 15000 |
Description: 108321-12-6 |
True Blue (TB) Diaceturate Salt |
||
Polysciences Europe GmbH | 1mg | Ask for price |
Description: 108321-12-6 |
True Blue (TB) Diaceturate Salt |
||
Polysciences Europe GmbH | 5mg | Ask for price |
Description: 108321-12-6 |
Goat True insulin ELISA kit |
||
BlueGene | 96T | EUR 700 |
Description: ELISA |
Pig Infectious mononucleosis IgG ELISA kit |
|||
E07I0001-192T | BlueGene | 192 tests | EUR 1524 |
Description: A sandwich ELISA for quantitative measurement of Porcine Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Pig Infectious mononucleosis IgG ELISA kit |
|||
E07I0001-48 | BlueGene | 1 plate of 48 wells | EUR 624 |
Description: A sandwich ELISA for quantitative measurement of Porcine Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Pig Infectious mononucleosis IgG ELISA kit |
|||
E07I0001-96 | BlueGene | 1 plate of 96 wells | EUR 822 |
Description: A sandwich ELISA for quantitative measurement of Porcine Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Dog Infectious mononucleosis IgG ELISA kit |
|||
E08I0001-192T | BlueGene | 192 tests | EUR 1524 |
Description: A sandwich ELISA for quantitative measurement of Canine Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Dog Infectious mononucleosis IgG ELISA kit |
|||
E08I0001-48 | BlueGene | 1 plate of 48 wells | EUR 624 |
Description: A sandwich ELISA for quantitative measurement of Canine Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Dog Infectious mononucleosis IgG ELISA kit |
|||
E08I0001-96 | BlueGene | 1 plate of 96 wells | EUR 822 |
Description: A sandwich ELISA for quantitative measurement of Canine Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Goat Infectious mononucleosis IgG ELISA kit |
|||
E06I0001-192T | BlueGene | 192 tests | EUR 1524 |
Description: A sandwich ELISA for quantitative measurement of Goat Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Goat Infectious mononucleosis IgG ELISA kit |
|||
E06I0001-48 | BlueGene | 1 plate of 48 wells | EUR 624 |
Description: A sandwich ELISA for quantitative measurement of Goat Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Goat Infectious mononucleosis IgG ELISA kit |
|||
E06I0001-96 | BlueGene | 1 plate of 96 wells | EUR 822 |
Description: A sandwich ELISA for quantitative measurement of Goat Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Mouse Infectious mononucleosis IgG ELISA kit |
|||
E03I0001-192T | BlueGene | 192 tests | EUR 1524 |
Description: A sandwich ELISA for quantitative measurement of Mouse Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Mouse Infectious mononucleosis IgG ELISA kit |
|||
E03I0001-48 | BlueGene | 1 plate of 48 wells | EUR 624 |
Description: A sandwich ELISA for quantitative measurement of Mouse Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Mouse Infectious mononucleosis IgG ELISA kit |
|||
E03I0001-96 | BlueGene | 1 plate of 96 wells | EUR 822 |
Description: A sandwich ELISA for quantitative measurement of Mouse Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human Infectious mononucleosis IgG ELISA kit |
|||
E01I0001-192T | BlueGene | 192 tests | EUR 1524 |
Description: A sandwich ELISA for quantitative measurement of Human Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human Infectious mononucleosis IgG ELISA kit |
|||
E01I0001-48 | BlueGene | 1 plate of 48 wells | EUR 624 |
Description: A sandwich ELISA for quantitative measurement of Human Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human Infectious mononucleosis IgG ELISA kit |
|||
E01I0001-96 | BlueGene | 1 plate of 96 wells | EUR 822 |
Description: A sandwich ELISA for quantitative measurement of Human Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Guinea Pig Infectious mononucleosis IgG ELISA |
|||
E01A40172 | BlueGene | 96T | EUR 700 |
Description: ELISA |
Rabbit Infectious mononucleosis IgG ELISA kit |
|||
E04I0001-192T | BlueGene | 192 tests | EUR 1524 |
Description: A sandwich ELISA for quantitative measurement of Rabbit Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |