Monoclonal antibody for SUR1 and SUR2B |
|
SMC-432D |
Stressmarq |
0.1mg |
EUR 423.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Igg Antibody Laboratories manufactures the igg antibody for waht infectoins reagents distributed by Genprice. The Igg Antibody For Waht Infectoins reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact igg antibody. Other Igg products are available in stock. Specificity: Igg Category: Antibody Group: For Waht
JBS True Blue |
|
MiTeGen |
300 µl |
EUR 16 |
|
Description: JBS True Blue |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 423.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
For Waht information
Human Infectiousmononucleosis IgG，IM-IgG ELISA Kit |
|
YLA2953HU-96T |
Shanghai YL Biotech |
96T |
Ask for price |
Plant Infectious Mononucleosis IgG (IM-IgG) ELISA Kit |
|
MBS9371697-INQUIRE |
MyBiosource |
INQUIRE |
Ask for price |
Rat Infectious mononucleosis IgG ELISA |
|
E01A13983 |
BlueGene |
96T |
EUR 700 |
|
Description: ELISA |
Rat Infectious mononucleosis IgG ELISA |
|
E02I0001-48wellsplate |
BlueGene |
48 wells plate |
EUR 280 |
Rat Infectious mononucleosis IgG ELISA |
|
E02I0001-96wellsplate |
BlueGene |
96 wells plate |
EUR 405 |
Goat Infectious mononucleosis IgG ELISA |
|
E01A48891 |
BlueGene |
96T |
EUR 700 |
|
Description: ELISA |
Goat Infectious mononucleosis IgG ELISA |
|
E06I0001-48wellsplate |
BlueGene |
48 wells plate |
EUR 280 |
Goat Infectious mononucleosis IgG ELISA |
|
E06I0001-96wellsplate |
BlueGene |
96 wells plate |
EUR 405 |
Human Infectious mononucleosis IgG ELISA |
|
E01A5229 |
BlueGene |
96T |
EUR 700 |
|
Description: ELISA |
Mouse Infectious mononucleosis IgG ELISA |
|
E01A22723 |
BlueGene |
96T |
EUR 700 |
|
Description: ELISA |
Sheep Infectious mononucleosis IgG ELISA |
|
E01A101184 |
BlueGene |
96T |
EUR 700 |
|
Description: ELISA |
Sheep Infectious mononucleosis IgG ELISA |
|
E14I0001-48wellsplate |
BlueGene |
48 wells plate |
EUR 280 |
Sheep Infectious mononucleosis IgG ELISA |
|
E14I0001-96wellsplate |
BlueGene |
96 wells plate |
EUR 405 |
Mouse Infectious mononucleosis IgG ELISA |
|
E03I0001-48wellsplate |
BlueGene |
48 wells plate |
EUR 280 |
