Vascular endothelial growth factor A

Vascular endothelial growth factor A

Member of the PDGF/VEGF growth factor family

Igg Antibody For Waht Infectoins

Monoclonal antibody for SUR1 and SUR2B

SMC-432D 0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Igg Antibody Laboratories manufactures the igg antibody for waht infectoins reagents distributed by Genprice. The Igg Antibody For Waht Infectoins reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact igg antibody. Other Igg products are available in stock. Specificity: Igg Category: Antibody Group: For Waht

True north Cryobox 15mLBlue

PK10
EUR 212.4

True north Cryobox 50mLNatural

PK10
EUR 210

True north Cryobox 50mLBlue

PK10
EUR 210

True north Cryobox1.5/2mLNatural

PK10
EUR 162

True north Cryobox1.5/2.0mLGreen

PK10
EUR 162

True north Cryobox 1.5/2.0mLBlue

PK10
EUR 100.8

True north Cryobox 1.5/2.0mLBlue

PK10
EUR 162

For Waht information

Human Infectious mononucleosis IgG ELISA kit

E01I0001-48 1 plate of 48 wells
EUR 624
Description: A sandwich ELISA for quantitative measurement of Human Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Infectious mononucleosis IgG ELISA kit

E01I0001-96 1 plate of 96 wells
EUR 822
Description: A sandwich ELISA for quantitative measurement of Human Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Infectious mononucleosis IgG ELISA kit

E04I0001-192T 192 tests
EUR 1524
Description: A sandwich ELISA for quantitative measurement of Rabbit Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Infectious mononucleosis IgG ELISA kit

E04I0001-48 1 plate of 48 wells
EUR 624
Description: A sandwich ELISA for quantitative measurement of Rabbit Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Infectious mononucleosis IgG ELISA kit

E04I0001-96 1 plate of 96 wells
EUR 822
Description: A sandwich ELISA for quantitative measurement of Rabbit Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Infectious mononucleosis IgG ELISA kit

E09I0001-192T 192 tests
EUR 1524
Description: A sandwich ELISA for quantitative measurement of Monkey Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Infectious mononucleosis IgG ELISA kit

E09I0001-48 1 plate of 48 wells
EUR 624
Description: A sandwich ELISA for quantitative measurement of Monkey Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Infectious mononucleosis IgG ELISA kit

E09I0001-96 1 plate of 96 wells
EUR 822
Description: A sandwich ELISA for quantitative measurement of Monkey Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Guinea pig Infectious mononucleosis IgG ELISA kit

E05I0001-192T 192 tests
EUR 1524
Description: A sandwich ELISA for quantitative measurement of Guinea pig Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Guinea pig Infectious mononucleosis IgG ELISA kit

E05I0001-48 1 plate of 48 wells
EUR 624
Description: A sandwich ELISA for quantitative measurement of Guinea pig Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Guinea pig Infectious mononucleosis IgG ELISA kit

E05I0001-96 1 plate of 96 wells
EUR 822
Description: A sandwich ELISA for quantitative measurement of Guinea pig Infectious mononucleosis IgG in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Virion infectivity factor Antibody

DF2418 200ul
EUR 420

Chicken Infectious Coryza Antibody ELISA Kit

abx055730-96tests 96 tests
EUR 801.6

Chicken infectious coryza antibody ELISA Kit

ELA-E2989d 96 Tests
EUR 1113.6

Modulator of Retrovirus Infection Homolog (MRI) Antibody

20-abx313941
  • EUR 493.20
  • EUR 2214.00
  • EUR 718.80
  • EUR 218.40
  • EUR 360.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Chicken Infectious Bronchitis Virus Antibody ELISA Kit

abx364912-96tests 96 tests
EUR 764.4

Rat Infectiousmononucleosis antibody(IM-Ab)ELISA Kit

QY-E10630 96T
EUR 433.2